REGIONS INDEX  ·  10 REGIONS  ·  149 LIVE OPERATIONS ESC TO CLOSE
02 · MAP · WA
Schematic
KIMPILGASMWTGFEWHTMETPELSWTGTS
Regional Development Commission boundaries · DPIRD
SERVICES INDEX  ·  11 CATEGORIES  ·  5 GROUPS  ·  61 MINE-SITE PAGES ESC TO CLOSE
Can’t find what you need? Browse the full catalog or list your business in a new category. BROWSE ALL → GET LISTED →
MINE × SERVICE · PROCUREMENT BRIEF

Mobile Heavy Diesel Mechanics at Billiard South.

Buyer-side sourcing analysis for engaging Mobile Heavy Diesel Mechanics contractors at Billiard South — what to specify, how to compare quotes, and what to verify before you award.

LIVE OPERATION · Billiard South REGION · Pilbara SERVICE · Mobile Heavy Diesel Mechanics

At a Glance

Operator
Hamersley Iron – Yandi Pty Limited (subsidiary of Rio Tinto Iron Ore)
Commodity
Iron Ore
Region
Pilbara — West Pilbara Mineral Field
Distance from Perth
1,071 km
Nearest hub
Newman (~75 km)
Stage
Operating
Ambient peak
48°C (sustained 45°C+)
Typical SLA
Emergency breakdown 2-4h / Extended mobilisation 12-24h
Roster
2/1 FIFO (typical)
Supplier portal
Avetta
Insurance min
AUD $20M PL / $10M PI

Service Requirements at Billiard South

Sustaining approximately 70–75 Mtpa of iron ore throughput across the combined Pocket and Billiard South operation places cyclic, high-intensity load on haul truck drivetrains, hydraulic systems, and ancillary plant that routinely exceeds standard OEM service intervals. The open pit, direct shipping ore extraction method — operating across Channel Iron Deposit geology — generates fine, abrasive particulate that accelerates filter, injector, and turbocharger wear cycles beyond what contractors calibrated for hard-rock operations will have encountered. Hamersley Iron – Yandi Pty Limited (subsidiary of Rio Tinto Iron Ore) operates this site under a FIFO model integrated with the Hamersley Iron rail network, meaning unplanned drivetrain downtime carries direct cost consequences that propagate to port terminal scheduling at Dampier and Cape Lambert. The existing automated truck fleet at Yandicoogina — adjacent to and operationally linked with Billiard South — further raises the technical bar: diesel mechanics must demonstrate familiarity with mixed-fleet environments that include both conventionally operated and autonomous-ready heavy equipment. Scope documentation should specify demonstrated MTTR (Mean Time To Repair) for haul truck powertrain faults in an open-pit iron ore environment as a minimum performance threshold.

  • Thermal derating compliance: Contractors must submit documented equipment derating protocols validated for sustained ambient temperatures of 45°C, with evidence of field application at peak conditions reaching 48°C — minimum 24 months of equivalent Pilbara site exposure within the last five years.
  • MTTR performance evidence: Tenderers must provide verified MTTR records from a comparable open-pit iron ore or bulk-commodity operation, demonstrating average unplanned haul truck repair resolution within 4 hours for drivetrain and engine faults, supported by site-sign-off documentation.
  • Fleet coverage capacity: Minimum crew deployment capability of four (4) trade-qualified heavy diesel fitters on site simultaneously, with documented surge capacity to double that complement within 24 hours via FIFO-accessible personnel pools, evidenced by prior mobilisation records.

Site-Specific Operational Constraints

Conditions procurement must communicate to all bidders in tender documentation for Billiard South.

  • Environment: Pilbara summer ambient sustained at 45°C, with recorded peaks to 48°C — diesel mechanics must operate in conditions where engine bay and undercarriage temperatures significantly exceed ambient. Fine Channel Iron Deposit dust loads air filtration systems and fuel systems at accelerated rates; tender documentation must specify dust-exposure maintenance intervals as a scope deliverable, not a contractor assumption.
  • Logistics: Billiard South sits approximately 1,071 km from Perth by road, placing it beyond same-day parts dispatch from metropolitan suppliers. Newman (~75 km) is the nearest serviceable hub. Contractors must demonstrate pre-positioned consumable stock — filters, injectors, belts, gaskets, and common wear components — held at or within 75 km of site, with a documented replenishment cycle that does not rely on Perth-origin next-day freight as a primary supply strategy.
  • Response SLA: Emergency call-out response for unplanned haul truck or primary plant diesel faults: 2–4 hours from notification to boots-on-equipment. Extended mobilisation for non-critical scheduled work: 12–24 hours. KPI-linked contract terms must include financial penalties for SLA breach, with MTTR evidence from equivalent operations required at tender stage — not post-award.
  • Roster: FIFO access via Paraburdoo or Tom Price aerodrome is the primary personnel mobilisation route. Contractors must submit a roster plan demonstrating continuous coverage across standard 12-hour shift patterns, with no single-point-of-failure dependency on one crew rotation. Standby technician availability during crew changeover windows must be explicitly addressed in the tender response.
  • Camp/facilities: Tender documentation must clarify site-provided versus contractor-provided accommodation arrangements with Hamersley Iron – Yandi Pty Limited (subsidiary of Rio Tinto Iron Ore) prior to RFQ issue. Where site camp access is granted, contractors remain responsible for compliance with site camp behavioural and fitness-for-work standards. Where site accommodation is not provided, contractors must demonstrate self-sufficient FIFO camp capability within commutable distance of Billiard South.

Contractor Capability Checklist

Minimum evaluation criteria for shortlisting Mobile Heavy Diesel Mechanics contractors at Billiard South. Each criterion must be verifiable via documentation submitted with tender response.

  • Technical certifications: OEM authorisation or documented service competency for the specific haul truck and ancillary plant models operating at Billiard South (to be confirmed in RFQ scope); AS 2790 compliance for diesel fuel handling where applicable; evidence of CID-environment service experience preferred and must be declared at tender.
  • Personnel tickets: All fitters must hold a current Certificate III in Heavy Commercial Vehicle Mechanical Technology (or equivalent recognised qualification) and a valid WA driver's licence appropriate to site vehicle class. Surface mining site induction competency and Rio Tinto Critical Risk Management Program awareness training must be completed prior to first mobilisation.
  • Mobilisation SLA: Documented evidence of achieving 2–4 hour emergency response times from a Pilbara-based operation within the last three years — site superintendent sign-off or equivalent third-party verification required; self-declared SLA claims are not acceptable at shortlist stage.
  • Public Liability insurance: Minimum AUD $20M per occurrence (Certificate of Currency required with tender submission — not to be provided post-award).
  • Professional Indemnity: Minimum AUD $10M aggregate where the contractor's scope includes technical specification of repair methodology, component substitution advice, or any written maintenance recommendations that influence plant integrity decisions.
  • Workers Compensation: Full statutory cover under WA law (WorkCover WA — Injury Management Plan required and must be submitted with tender response).
  • Site exposure: Minimum three (3) years of continuous or recent engagement on an open-pit iron ore or equivalent bulk-commodity operation, with demonstrated experience servicing high-utilisation haul truck fleets in ambient conditions at or above 45°C. DSO or CID operational exposure must be declared and referenced.
  • Safety systems: ISO 45001-certified HSE management system (or equivalent documented system with third-party audit history); demonstrated ICAM investigation capability is mandatory given Rio Tinto's Critical Risk Management Program requirements at this site.

Regulatory & HSE Framework

The applicable regulatory framework is the Work Health and Safety Act 2020 (WA) and the Work Health and Safety (Mines) Regulations 2022 (WA), administered by WorkSafe WA. For mobile diesel mechanics operating in an open-pit environment, this framework carries specific implications: all plant and equipment brought to site must meet prescribed design registration requirements, and any contractor performing high-risk work — including work on pressurised fuel and hydraulic systems — must hold the relevant WA high-risk work licence class. Rio Tinto's HSEC Standards and Critical Risk Management Program, published at riotinto.com/sustainability, form the site-level overlay above the statutory minimum and are non-negotiable for all contractors engaged at Billiard South. Workforce compliance and onboarding are managed through the Avetta platform (rio tinto login: https://www.avetta.com/login/riotinto) — registration and current compliance status on Avetta are prerequisites for mobilisation; procurement teams issuing RFQs must confirm portal registration status as part of prequalification, not as a post-award action. All contractors must complete site-specific induction via Hamersley Iron – Yandi Pty Limited (subsidiary of Rio Tinto Iron Ore) procedures before mobilisation, with induction records retained and available for WorkSafe WA audit on request.

Sourcing Qualified Contractors

No confirmed tender activity for Mobile Heavy Diesel Mechanics at Billiard South is on record at the time of this briefing; procurement teams issuing a new RFQ are entering a market without a publicly documented incumbent panel, which increases the importance of rigorous prequalification at shortlist stage rather than relying on prior engagement history.

The regional labour pool for heavy diesel mechanics in the Pilbara is centred on Newman (~75 km from Billiard South), with an estimated three to five or more active providers operating across the region at any given time — a relatively constrained market given the concurrent demand from multiple Rio Tinto, BHP, and independent operations across the West Pilbara Mineral Field. Contractors with confirmed regional exposure include SHIFT Diesel and Earth (Newman-based), Marlee Resources (Indigenous-owned, operating across WA), and Everything Diesel (Pilbara-active) — noted as market reference only, not as endorsement or recommendation by this briefing.

Given the constrained regional pool and the FIFO mobilisation dependency via Paraburdoo or Tom Price aerodrome, procurement teams engaging this market must allow a minimum of six to eight weeks for prequalification, Avetta compliance verification, and onboarding through the Rio Tinto supplier portal (SAP Ariba: riotinto.com/suppliers/supplier-portals) before any realistic mobilisation date can be committed. Compressing this timeline by issuing scope before prequalification is complete creates SLA risk that the KPI-linked contract terms are designed to penalise — the sequence must be portal registration, prequalification, then RFQ issue.

Sourcing Mobile Heavy Diesel Mechanics for Billiard South?

Register to be notified as verified Pilbara providers are listed for this site.

Notify Me When Providers Are Listed
● FREE FOR BUYERS · NO OBLIGATION

Get 3 verified providers for Mobile Heavy Diesel Mechanics at Billiard South.

Tell us what you need. We’ll match you with up to 3 verified WA suppliers and email you their details — usually within one business day. Urgent jobs are prioritised.

Free for buyers. We verify ABN, contact and credentials — we don’t rank by who pays.

Same service · nearby sites

Same Service at Nearby Mines